Products 1-48 of 56
ARX Reel ARX Reel
Retail: $439.95
Price: $307.95-$367.95
Availability: In Stock 1-2 day
Item #: ARX -

ARX Spool ARX Reel
Retail: $200.95
Price: $140.95-$165.95
Availability: In Stock 1-2 day
Item #: AR -

Bougle Reel 3-1/2" Bougle Reel 3-1/2"
Price: $595.00
Availability: In Stock 1-2 day
Item #: HEB040 -

Bougle Reel 4" Bougle Reel 4"
Price: $595.00
Availability: In Stock 1-2 day
Item #: HEB050 -

BVK Super Large Arbor Spool BVK Super Large Arbor Spool
Price: $84.95
Availability: In Stock 1-2 day
Item #: TFRBVK -

Duchess Reel, 4" Duchess Reel size 9/10/11
Price: $549.00
Availability: In Stock 1-2 day
Item #: HREDUCG040 -

The first new Hardy ‘classic reel' in over a decade. Handmade in Alnwick, England by skilled craftsmen, the Duchess features innovative features including a split frame design and dual line guards within a classically styled high quality reel. ...

Echo Ion Reel Echo Ion Reel
Price: $99.99
Availability: In Stock 1-2 day
Item #: ION- -

The Echo Ion Reels are the best fly fishing reels we have seen in the less than $100 category. They are a hybrid design, in that they are injection molded cast aluminum, then they are machined to very exacting tolerances. This operation gives many of the benefits associated with reels that are machined from bar-stock, but with a huge reduction in manufacturing costs. This results in massive savings to the consumer (you). These reels contain ball bearings and a cork disc drag system, all of...

Echo Ion Spool Echo Ion Spool
Price: $44.95
Availability: In Stock 1-2 day
Item #: ION -

Guru Series II Reel Lamson Guru Series II Reel
Price: $199.95-$269.95
Availability: In Stock 1-2 day
Item #: G -

Steadfast and stylish, Guru has long set a standard as a rugged, fully USA-machined ultra-reliable reel at a great price. This season they've updated Guru's spool geometry for enhanced retrieve rates, opened the porting to reduce weight and improve line drying, integrated the counterbalance and introduced a curved cross section arbor for structural stability. Guru continues to prove that the quest for enlightenment can be anything but boring. MODEL DIA WIDTH WEIGHT ROD WT LINE CAPACITY Guru 1...

Guru Series II Spool Guru Series II
Price: $99.95-$129.95
Availability: In Stock 1-2 day

Steadfast and stylish, Guru has long set a standard as a rugged, fully USA-machined ultra-reliable reel at a great price. This season we've updated Guru's spool geometry for enhanced retrieve rates, opened the porting to reduce weight and improve line drying, integrated the counterbalance and introduced a curved cross section arbor for structural stability. Guru continues to prove that the quest for enlightenment can be anything but boring. MODEL DIA WIDTH WEIGHT ROD WT LINE CAPACITY Guru 1...

Hardy ASR Fly Reel, quartering front view, picture
Price: $299.99
Availability: In Stock 1-2 day
Item #: HREASRT0 -

The Hardy ASR Fly Fishing Reel The Hardy ASR is certainly the most modern cassette fly fishing reel. Possibly the ultimate "system" reel, the new Hardy ASR (Assisted Spool Release) reel features a fast, easy to use spool release system that actively frees the spool at the flick of a switch and automatically engages the new spool with a simple push fit. Also new to this range is a lightweight size specifically designed for the challenges of modern river fishing. This is at present, the ultimate...

Hardy Cascapedia Fly Reel, angle shot, picture.
Price: $799.00
Availability: In Stock 1-2 day
Item #: HRECAFB -

Hardy Cascapedia - possibly the world's finest salmon/steelhead reel. The Cascapedia is a modern classic fly reel. Two Spey sizes are offered: 8/9 weighing 12.7-ounces for rods of 13-14', requiring 7/8/9 weight fly lines, and 10/11 weighing 14-ounces for rods of 13-15', requiring 9/10/11 weight fly lines. A fully adjustable disc drag will exert enough pressure to land very large salmon, or steelhead. These reels are weighted to balance perfectly with two-hand rods.The disc drag is augmented by...

Hardy Marquis LWT Reel Hardy, Marquis LWT, Fly Reel, designed and first produced more than 40-years ago, now made from the most modern materials
Price: $329.00-$449.00
Availability: In Stock 1-2 day
Item #: HREMARGO -

Hardy Marquis Fly Fishing Reels The Marquis has been a mainstay of the Hardy line since the early 1970's when it was introduced to the US market as the Scientific Anglers System Reel. Thousands of Americans bought this English-made reel and most of them are still in use. The LTW is actually the third generation of the Marquis. Each generation has shown subtle improvements in performance without sacrificing the simplicity and rugged performance of the original Marquises. All the spools are...

The Hardy Ultralite SDSL Fly Reel, quartering, front, picture
Price: $428.99
Availability: In Stock 1-2 day
Item #: HRESDLS0 -

The Hardy Ultralite SDSL Fly ReelThe first thing that caught our attention was the outstanding good look of this series of reels. Fishing tackle doesn't have to be pretty, but it doesn't hurt if it is. Many anglers who live in the Pacific Northwest (and other parts of the world) use the same reels for both Spey fishing and for medium to heavy saltwater fly fishing. This happens quite naturally because reels for these two different types of fly fishing happen to have very similar capacities and...

Hatch 11 Plus Gen 2 Finatic Reels Hatch 11 Plus Gen 2 Finatic Reels, Fly Reels , Hatch Outdoors Finatic Reels
Price: $875.00
Availability: In Stock 1-2 day
Item #: H11P -

The goal was to create a larger reel that bridged the gap between the 9 and 12 Plus models. We also wanted to make sure it had an over-sized handle for greater grip control when fighting those big silver critters. The mid arbor option is also great for spey rods from 13.5–14.5 feet.Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod,...

Hatch 12 Plus Gen 2 Finatic Reels Hatch 12 Plus Gen 2 Finatic Reels, Fly Reels , Hatch Outdoors Finatic Reels
Price: $950.00
Availability: In Stock 1-2 day
Item #: H12P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Hatch 2 Plus Gen 2 Finatic Reels Hatch 2 Plus Gen 2 Finatic, Fly Reels , Hatch Outdoors Finatic Reels
Price: $430.00
Availability: In Stock 1-2 day
Item #: H2P -

Small water perfection. The 2 Plus is rated for 2 through 4 weight lines, weighs only 3.2 oz. without line, and measures 3” in diameter. Match up with your favorite lightweight fly rod and you’re ready to fish any small stream, lake, or favorite dry fly stretch of water. Fully CNC machined in Vista, CA with a proprietary Rulon/Stainless Steel stacked disk drag, the 2 Plus is available in 6 color options and Large arbor only. Looking for extra spools?Hatch Rep, Bruce Berry spent some time at...

Hatch 3 Plus Gen 2 Finatic Reels Hatch 3 Plus Gen 2 Finatic , Hatch Outdoors Finatic Reels
Price: $450.00
Availability: In Stock 1-2 day
Item #: H3P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Hatch 4 Plus Gen 2 Finatic Reels Hatch 4 Plus Gen 2 Finatics , Hatch Outdoors Finatic Reels
Price: $500.00
Availability: In Stock 1-2 day
Item #: H4P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Hatch 5 Plus Gen 2 Finatic Reels Hatch 5 Plus Gen 2 Finatic , Hatch Outdoors Finatic Reels
Price: $550.00
Availability: In Stock 1-2 day
Item #: H5P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Hatch 7 Plus Gen 2 Finatic Reels Hatch 7 Plus Gen 2 Finatic Fly Reels , Hatch Outdoors Finatic Reels
Price: $650.00
Availability: In Stock 1-2 day
Item #: H7P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Hatch 9 Plus Gen 2 Finatic Reels Hatch 9 Plus Gen 2 Finatic, Fly Reels , Hatch Outdoors Finatic Reels
Price: $800.00
Availability: In Stock 1-2 day
Item #: H9P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Hatch Custom Shop Generation 2 Finatic 7 Plus Reel in Gold Hatch Custom Shop Generation 2 Finatic 7 Plus Reel in Gold
Price: $700.00
Availability: Limited to Stock On Hand

The NEW Generation 2 Finatic fly reel - an evolutionary update from Hatch’s original tried and true Finatic. Consistent with their uncompromising commitment to premium quality, there have been several significant performance improvements and aesthetic enhancements including: new 9 Window frame design, non-reflective mist finish, non-stick cranks, concave frame design for additional weight relief, and Teflon lip seals and sealed bearings that add a whole new level of protection against the...

Hatch Custom Shop Generation 2 Finatic 9 Plus Reel in Gold Hatch Custom Shop Generation 2 Finatic 9 Plus Reel in Gold
Price: $850.00
Availability: Limited to Stock On Hand

The NEW Generation 2 Finatic fly reel - an evolutionary update from Hatch’s original tried and true Finatic. Consistent with their uncompromising commitment to premium quality, there have been several significant performance improvements and aesthetic enhancements including: new 9 Window frame design, non-reflective mist finish, non-stick cranks, concave frame design for additional weight relief, and Teflon lip seals and sealed bearings that add a whole new level of protection against the...

Hatch Spool 11 Plus Gen 2 Mid-Arbor Hatch Spool 11 Plus Gen 2 Mid-Arbor, Fly Reels , Hatch Outdoors Finatic Reels
Price: $405.00
Availability: In Stock 1-2 day
Item #: H11PEXS -

Hatch Spool 12 Plus Gen 2 Mid-Arbor Hatch Spool 12 Plus Gen 2 Mid-Arbor, Fly Reels , Hatch Outdoors Finatic Reels
Price: $430.00
Availability: In Stock 1-2 day
Item #: H12PEXS -

Hatch Spool 3 Plus Gen 2 Mid-Arbor Hatch Spool 3 Plus Gen 2 Mid-Arbor, Fly Reels , Hatch Outdoors Finatic Reels
Price: $200.00
Availability: In Stock 1-2 day
Item #: H3PEXS -

Hatch Spool 4 Plus Gen 2 Mid-Arbor Hatch Spool 4 Plus Gen 2 Mid-Arbor, Fly Reels , Hatch Outdoors Finatic Reels
Price: $205.00
Availability: In Stock 1-2 day
Item #: H4PEXS -

Hatch Spool 5 Plus Gen 2 Mid-Arbor Hatch Spool 5 Plus Gen 2 Mid-Arbor, Hatch Outdoors Finatic Reels
Price: $235.00
Availability: In Stock 1-2 day
Item #: H5PEXS -

Hatch Spool 7 Plus Gen 2 Mid-Arbor Hatch Spool 7 Plus Gen 2 Mid-Arbor, Fly Reels , Hatch Outdoors Finatic Reels
Price: $255.00
Availability: In Stock 1-2 day
Item #: H7PEXS -

Hatch Spool 9 Plus Gen 2 Mid-Arbor Hatch Spool 9 Plus Gen 2 Mid-Arbor, Fly Reels , Hatch Outdoors Finatic Reels
Price: $380.00
Availability: In Stock 1-2 day
Item #: H9PEXS -

Liquid 1.5-2 Liquid
Price: $99.95
Availability: In Stock 1-2 day
Item #: LQ -

Liquid 3.5-4 Liquid
Retail: $99.95
Price: $59.95
Availability: In Stock 1-2 day
Item #: LQ- -

Loon Reel Lube Loon Reel Lube
Price: $5.50
Availability: In Stock 1-2 day
Item #: 401 -

A combination of lubricants and water repellent, Reel Lube gives reels extended protection from rust and friction. It will increase the performance and lifetime of a reel.

Loop Classic Reel Loop Classic Reel
Retail: $679.00
Price: $569.00-$769.00
Availability: In Stock 1-2 day
Item #: CR- -

There are very few classic American type fly reels available on the market today. Those that have survived are mostly built by small shops at huge prices. The Loop Classic is both more affordable and more reliable than any of the competitors. The Loop Classic is equipped with ventilated or solid side-plates. I have owned a Loop Classic 811 since first production in the early 1990's. It is my favorite reel for hunting very large anadromous fish in large rivers, because the drag system can get...

Marquis Reel Marquis Reel
Price: $325.00
Availability: In Stock 1-2 day
Item #: HREM0 -

Prism Cast Large Arbor Spool Prism Cast Large Arbor Spool
Price: $44.95
Availability: In Stock 1-2 day
Item #: TFR P CLA -

Consistent with TFO's tradition of offering high performance gear at an affordable price, the new Prism Cast Large Arbor Reels are made from cast aluminum with a cork disc drag and a one way clutch bearing for instant drag engagement. They feature quick change spools and easy LH/RH conversion.The Prism Series are very good reels at affordable prices.MODELDESCRIPTIONDIAMETERWIDTHWEIGHTCAPACITYPRICETFR P CLA 3/4TFO Prism Cast Large Arbor Reel 3/42.75"1"4.9 oz.80 yards/20lb./WF3F$89.95TFR P CLA...

Redington Behemoth Fly Fishing Reel Redington, Behemoth, Fly Fishing Reel, high performance, affordable price,
Price: $109.95
Availability: In Stock 1-2 day
Item #: 5-5506R -

Redington Behemoth Fly Fishing ReelsMonster performance at affordable prices. Sizes for nearly every fly fishing application. Nor wind, nor rain, nor dunking in water, nor big fish, nor clumsy anglers; nothing seems to defeat the Behemoth. This is one of the most reliable reels out there!Redington's new BEHEMOTH reel combines the most powerful drag in its class with stunning aesthetics that push the limits of fly reel design. The unique, un-machinable, die-cast construction is coupled with a...

Sage 4600 Series Reels Sage 4600 Series Reels
Price: $375.00-$450.00
Availability: In Stock 1-2 day
Item #: 320-46 -

True large arbor performance with innovative features.This large arbor reel features a notably larger-diameter spool and arbor for faster line retrieval and consistently smooth drag during battle. Its larger size contributes to added rigidity and strength for overall performance. The inner arbor is concave for greater line and backing capacity. Lightweight and streamlined, the 4600 series has a powerful 3:1 drag ratio that gives it the same performance as a traditional centered disc drag...

Sage 8080 Pro Reel, Stealth, front, picture
Retail: $750.00
Price: $625.00
Availability: In Stock 1-2 day
Item #: 32-8080RST -

Built upon the proven foundation of the 6000 series, the all-new and larger 8000 PRO is designed for tackling big-game saltwater species. The 8000 PRO gives you a new dimension of fish-stopping power via an integrated, secondary drag control mechanism, to fine-tune and calibrate your drag. With its unique two-stage drag control, you can dial-up new degrees of fish-fighting resistance at the high end, in anticipation of the species you�re targeting. Simultaneously, you can set your preferred...

Sage Click Reels Sage Click Reels
Price: $259.00-$299.00
Availability: In Stock 1-2 day
Item #: 323-C -

Sage's new CLICK Series reels are a performance and cosmetic upgrade from the original CLICK series. The enhanced CLICK features larger arbor diameters creating a larger palming area for fighting fish and quicker line retrieval while maintaining backing capacities. The CLICK aesthetic has been elevated through new hole patterns and a refreshed, modern design that speaks to its lightweight and minimalist yet functional characteristics. The proven performance of the adjustable click and pawl...

Sage Domain Reels Sage Domain Reels
Retail: $365.00
Price: $227.00
Availability: In Stock 1-2 day
Item #: 321-DMN -

Sage Domain ReelsA full-frame reel speaks to tradition and a design aesthetic favored by many, particularly two-handed enthusiasts. Ah, but when tradition and modern-day advantages like a large arbor and Sage's powerful, maintenance-free SCS drag are married, a new dimension of elegance and performance are attained. Introducing Sage's all-new, decidedly high-performance full-frame reel, the Domain. The Domain's line-protecting full frame removes any remote concern about running line or backing...

Sage Evoke Reels Sage Evoke Reels
Retail: $575.00
Price: $345.00-$365.00
Availability: In Stock 1-2 day
Item #: 34-EVK -

Sage Evoke Reels Here Simon Gawesworth releases a Deschutes River steelhead he landed with his Evoke-8 and a new Sage 7130-4X. It is easier to be successful when you use the world's best tackle.Putting more stopping power in your hands. The designers at Sage asked themselves what many of the most hardcore fly fishers who take on big anadromous fish and powerful saltwater species want in a fly reel. The answer, like their innovative solution, was simple: more control. You wanted to add extra...

Sage SPECTRUM Reel Sage SPECTRUM Reel, all new for 2018, fully machined, waterproof drag, four sizes, trout, steelhead, salmon, saltwater
Price: $249.00-$299.00
Availability: In Stock 1-2 day
Sage Item #: 34-3200 -

Sage SPECTRUM Reels The Spectrum replaces the popular Sage 4200 reels series. All NEW for 2018, the fully machined SPECTRUM is a true large arbor performance fly reel suitable for both freshwater and saltwater use. With concave spool surface for optimal line capacity and drag-assisting smoothness, the SPECTRUM is lightweight, extremely durable, and packed with features you’d expect on higher priced reels. SPECTRUM reels come in sizes: 3/4, 5/6, 7/8, and 9/10, which means there are sizes for...

Simms Bounty Hunter Mesh Reel Pouch Simms, Bounty Hunter, Mesh Reel Pouch, fly reel case, protective reel cover, fits reel while on rod
Price: $19.95
Availability: In Stock 1-2 day
Item #: 1183 -

Simms Bounty Hunter Mesh Reel Pouch Maybe you bought your reel used, or bought your reel new, then lost the cover. Or maybe the cover your new reel came with was made from some kind of material that soaked up saltwater and stayed that way your whole bonefish trip. Or maybe you saltwater fishing is your main fishery. There are many reasons why you need the new innovative, quick-drying reel pouches from Simms. They fit large or medium-size fly fishing reels. The Bounty Hunter Mesh Pouch features...

Speedster Reel Speedster Reel
Price: $299.95
Availability: In Stock 1-2 day
Item #: Speedster -

Making a good thing better is what our company is about. The Speedster is a super-high retrieve rate reel with a narrower spool, inboard mounted handle and an outer diameter significantly larger than our highest performing reels. The narrow spool prevents line barreling, the added circumference and inboard handle improve retrieve rate. Mate these features with our time tested smooth as silk, maintenance free drag system, Classic Waterworks Lamson styling and attention to detail, and you have...

Speedster Spool Speedster Spool
Price: $140.95
Availability: In Stock 1-2 day
Item #: Speed -

Super Lube Super Lube
Price: $5.00
Availability: In Stock 1-2 day
Item #: Super Lube -

Super Lube is a patented, multi-purpose synthetic lubricant, containing SYNCOLON (PTFE) particles held in suspension. Super Lube lasts longer and outperforms conventional petroleum-based greases and oils. Works best in "click-pawl" type reels or anywhere maximum friction could occur between metal parts.