Products 1-48 of 58
Show
ARX Reel ARX Reel
Price: $439.95-$499.95
Availability: In Stock 1-2 day
Item #: ARX -

ARX Spool ARX Reel
Price: $200.95-$225.95
Availability: In Stock 1-2 day
Item #: AR -

Behemoth
Price: $109.95
Availability: In Stock 1-2 day
Item #: 5-5506R -

Redington's new BEHEMOTH reel combines the most powerful drag in its class with stunning aesthetics that push the limits of fly reel design. The unique, un-machinable, die-cast construction is coupled with a durable, interlocking, large-arbor spool design that both looks and functions like a premium reel. A super-heavy duty carbon fiber drag package brings the utmost in drag strength, reliability and performance to the family. Sized for your favorite 5-weight trout rod, and all the way up to...

Bougle Reel 3-1/2" Bougle Reel 3-1/2"
Price: $595.00
Availability: In Stock 1-2 day
Item #: HEB040 -

Bougle Reel 4" Bougle Reel 4"
Price: $595.00
Availability: In Stock 1-2 day
Item #: HEB050 -

Bougle Spool 3" Bougle Spool 3"
Price: $99.00
Availability: In Stock 1-2 day
Item #: HSB020 -

Bougle Spool 3-1/2" Bougle Spool 3-1/2"
Price: $99.00
Availability: In Stock 1-2 day
Item #: HSB040 -

Bougle Spool 3-1/4" Bougle Spool 3-1/4"
Price: $99.00
Availability: In Stock 1-2 day
Item #: HSB030 -

Bougle Spool 4" Bougle Spool 4"
Price: $119.00
Availability: In Stock 1-2 day
Item #: HSB050 -

BVK Super Large Arbor Reel BVK Super Large Arbor Reel
Price: $159.95
Availability: In Stock 1-2 day
Item #: TFR BVK -

The story is that Lefty Kreh grew up poor, and while on the way to becoming the world's most recognized and most beloved fly angler, he also learned the art of being thrifty. Lefty is an incredible athlete in his own right. In his youth, Lefty was so uncanny in the shooting sports that Remington Firearms Company hired him to demonstrate their rifles and shot guns in front of huge crowds. During mid-life Lefty wowed thousand of anglers at sport shows my demonstrating fly casting. In his heyday...

BVK Super Large Arbor Spool BVK Super Large Arbor Spool
Price: $84.95
Availability: In Stock 1-2 day
Item #: TFRBVK -

Duchess Reel, 4" Duchess Reel size 9/10/11
Price: $549.00
Availability: In Stock 1-2 day
Item #: HREDUCG040 -

Duchess Spool, 4" Duchess Spool size 9/10/11
Price: $189.00
Availability: In Stock 1-2 day
Item #: HSPDUCG040 -

Echo Ion Reel Echo Ion Reel
Price: $99.99
Availability: In Stock 1-2 day
Item #: ION- -

The Echo Ion Reels are the best fly fishing reels we have seen in the less than $100 category. They are a hybrid design, in that they are injection molded cast aluminum, then they are machined to very exacting tolerances. This operation gives many of the benefits associated with reels that are machined from bar-stock, but with a huge reduction in manufacturing costs. This results in massive savings to the consumer (you). These reels contain ball bearings and a cork disc drag system, all of...

Echo Ion Spool Echo Ion Spool
Sale!
Price: $44.95
Availability: In Stock 1-2 day
Item #: ION -

Finatic  3 Plus Reel Finatic 3 Plus Reel, Fly Reels , Hatch Outdoors Finatic Reels
Price: $400.00
Availability: In Stock 1-2 day
Item #: H3P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  3 Plus Spool Finatic 3 Plus Spool, Fly Reels , Hatch Outdoors Finatic Reels
Price: $175.00
Availability: In Stock 1-2 day
Item #: H3PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  4 Plus Reel Finatic 4 Plus Reel, Fly Reels , Hatch Outdoors Finatic Reels
Price: $450.00
Availability: In Stock 1-2 day
Item #: H4P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  4 Plus Spool Finatic 4 Plus Spool, Fly Reels , Hatch Outdoors Finatic Reels
Price: $190.00
Availability: In Stock 1-2 day
Item #: H4PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  5 Plus Reel Finatic 5 Plus Reel, Fly Reels , Hatch Outdoors Finatic Reels
Price: $500.00
Availability: In Stock 1-2 day
Item #: H5P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  5 Plus Spool Finatic 5 Plus Spool, Fly Reels , Hatch Outdoors Finatic Reels
Price: $205.00
Availability: In Stock 1-2 day
Item #: H5PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  7 Plus Reel Finatic 7 Plus Reel, Fly Reels , Hatch Outdoors Finatic Reels
Price: $600.00
Availability: In Stock 1-2 day
Item #: H7P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  7 Plus Spool Finatic 7 Plus Spool, Fly Reels , Hatch Outdoors Finatic Reels
Price: $225.00
Availability: In Stock 1-2 day
Item #: H7PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  9 Plus Reel Finatic 9 Plus Reel, Fly Reels , Hatch Outdoors Finatic Reels
Price: $750.00
Availability: In Stock 1-2 day
Item #: H9P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  9 Plus Spool Finatic 9 Plus Spool, Fly Reels , Hatch Outdoors Finatic Reels
Price: $350.00
Availability: In Stock 1-2 day
Item #: H9PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic 11 Plus Reel Finatic 11 Plus Reel, Fly Reels , Hatch Outdoors Finatic Reels
Price: $825.00
Availability: In Stock 1-2 day
Item #: H11P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic 11 Plus Spool Finatic 11 Plus Spool, Fly Reels , Hatch Outdoors Finatic Reels
Price: $375.00
Availability: In Stock 1-2 day
Item #: H11PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic 12 Plus Reel Finatic 12 Plus Reel, Fly Reels , Hatch Outdoors Finatic Reels
Price: $900.00
Availability: In Stock 1-2 day
Item #: H12P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic 12 Plus Spool Finatic 12 Plus Spool, Fly Reels , Hatch Outdoors Finatic Reels
Price: $400.00
Availability: In Stock 1-2 day
Item #: H12PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Guru Series II Reel Lamson Guru Series II Reel
Price: $199.95-$269.95
Availability: In Stock 1-2 day
Item #: G -

Steadfast and stylish, Guru has long set a standard as a rugged, fully USA-machined ultra-reliable reel at a great price. This season they've updated Guru's spool geometry for enhanced retrieve rates, opened the porting to reduce weight and improve line drying, integrated the counterbalance and introduced a curved cross section arbor for structural stability. Guru continues to prove that the quest for enlightenment can be anything but boring. MODEL DIA WIDTH WEIGHT ROD WT LINE CAPACITY Guru 1...

Guru Series II Spool Guru Series II
Price: $99.95-$129.95
Availability: In Stock 1-2 day

Steadfast and stylish, Guru has long set a standard as a rugged, fully USA-machined ultra-reliable reel at a great price. This season we've updated Guru's spool geometry for enhanced retrieve rates, opened the porting to reduce weight and improve line drying, integrated the counterbalance and introduced a curved cross section arbor for structural stability. Guru continues to prove that the quest for enlightenment can be anything but boring. MODEL DIA WIDTH WEIGHT ROD WT LINE CAPACITY Guru 1...

Hatch Custom Shop Generation 2 Finatic 7 Plus Reel in Gold Hatch Custom Shop Generation 2 Finatic 7 Plus Reel in Gold
Price: $700.00
Availability: Limited to Stock On Hand
Item #: CUSTOM-F7P-GLBK-LA -

The NEW Generation 2 Finatic fly reel - an evolutionary update from Hatch’s original tried and true Finatic. Consistent with their uncompromising commitment to premium quality, there have been several significant performance improvements and aesthetic enhancements including: new 9 Window frame design, non-reflective mist finish, non-stick cranks, concave frame design for additional weight relief, and Teflon lip seals and sealed bearings that add a whole new level of protection against the...

Hatch Custom Shop Generation 2 Finatic 9 Plus Reel in Gold Hatch Custom Shop Generation 2 Finatic 9 Plus Reel in Gold
Price: $850.00
Availability: Limited to Stock On Hand
Item #: CUSTOM-F9P-GLBK-LA -

The NEW Generation 2 Finatic fly reel - an evolutionary update from Hatch’s original tried and true Finatic. Consistent with their uncompromising commitment to premium quality, there have been several significant performance improvements and aesthetic enhancements including: new 9 Window frame design, non-reflective mist finish, non-stick cranks, concave frame design for additional weight relief, and Teflon lip seals and sealed bearings that add a whole new level of protection against the...

Liquid Liquid
Price: $99.95
Availability: In Stock 1-2 day
Item #: LQ -

Loon Reel Lube Loon Reel Lube
Price: $5.50
Availability: In Stock 1-2 day
Item #: 401 -

A combination of lubricants and water repellent, Reel Lube gives reels extended protection from rust and friction. It will increase the performance and lifetime of a reel.

Loop Classic Reel Loop Classic Reel
Retail: $679.00
Price: $569.00-$769.00
(2)
Availability: In Stock 1-2 day
Item #: CR- -

There are very few classic American type fly reels available on the market today. Those that have survived are mostly built by small shops at huge prices. The Loop Classic is both more affordable and more reliable than any of the competitors. The Loop Classic is equipped with ventilated or solid side-plates. I have owned a Loop Classic 811 since first production in the early 1990's. It is my favorite reel for hunting very large anadromous fish in large rivers, because the drag system can get...

Marquis LWT Reel Marquis Reel No. 3
Price: $329.00-$449.00
Availability: In Stock 1-2 day
Item #: HREMARGO -

The Marquis has been a mainstay of the Hardy line since the early 1970's when it was introduced to the US market as the Scientific Anglers System Reel. Thousands of Americans bought this English-made reel and most of them are still in use. The LTW is actually the third generation of the Marquis. Each generation has shown subtle improvements in performance without sacrificing the simplicity and rugged performance of the original Marquises. All the spools are interchangeable with all other...

Marquis Reel Marquis Reel
Price: $325.00
Availability: In Stock 1-2 day
Item #: HREM0 -

Marquis Spool Marquis Spool
Price: $89.00-$109.00
Availability: In Stock 1-2 day
Item #: HSPM0 -

Prism Cast Large Arbor Reel Prism Cast Large Arbor Reel
Price: $99.95
Availability: In Stock 1-2 day
Item #: 8332S -

Prism Cast Large Arbor Spool Prism Cast Large Arbor Spool
Price: $44.95
Availability: In Stock 1-2 day
Item #: TFR P CLA -

Consistent with TFO's tradition of offering high performance gear at an affordable price, the new Prism Cast Large Arbor Reels are made from cast aluminum with a cork disc drag and a one way clutch bearing for instant drag engagement. They feature quick change spools and easy LH/RH conversion.The Prism Series are very good reels at affordable prices.MODELDESCRIPTIONDIAMETERWIDTHWEIGHTCAPACITYPRICETFR P CLA 3/4TFO Prism Cast Large Arbor Reel 3/42.75"1"4.9 oz.80 yards/20lb./WF3F$89.95TFR P CLA...

Sage 2200 Series Reels Sage 2200 Series Reels
Price: $129.00-$159.00
Availability: In Stock 1-2 day
Item #: 330-22 -

Own "wow" for less. Sage is further expanding the popularity of their hard-fighting 4200 series with the all-new, value conscious 2200 series. A large arbor with rugged machined die-cast frame, generous concave spool surface, whisper-smooth carbon drag and unexpected finishing touches like its fully machined drag knob and handle, the 2200 gives you more than the fish bargained for.

Sage 4210 Spool 4210 Spool
Sale!
Retail: $160.00
Price: $96.00
Availability: In Stock 1-2 day
Item #: 322-4210S -

Sage 4230 Spool 4230 Spool
Sale!
Retail: $145.00
Price: $87.00
Availability: In Stock 1-2 day
Item #: 322-4230S -

Sage 4250 Spool 4250 Drag Spool
Sale!
Retail: $150.00
Price: $90.00
Availability: In Stock 1-2 day
Item #: 322-4250S -

Sage 4600 Series Reels Sage 4600 Series Reels
Price: $375.00-$450.00
Availability: In Stock 1-2 day
Item #: 320-46 -

True large arbor performance with innovative features.This large arbor reel features a notably larger-diameter spool and arbor for faster line retrieval and consistently smooth drag during battle. Its larger size contributes to added rigidity and strength for overall performance. The inner arbor is concave for greater line and backing capacity. Lightweight and streamlined, the 4600 series has a powerful 3:1 drag ratio that gives it the same performance as a traditional centered disc drag...

Sage Click Reels Sage Click Reels
Price: $259.00-$299.00
Availability: In Stock 1-2 day
Item #: 323-C -

Sage's new CLICK Series reels are a performance and cosmetic upgrade from the original CLICK series. The enhanced CLICK features larger arbor diameters creating a larger palming area for fighting fish and quicker line retrieval while maintaining backing capacities. The CLICK aesthetic has been elevated through new hole patterns and a refreshed, modern design that speaks to its lightweight and minimalist yet functional characteristics. The proven performance of the adjustable click and pawl...

Sage Domain Reels Sage Domain Reels
Price: $345.00-$385.00
Availability: In Stock 1-2 day
Item #: 321-DMN -

Sage Domain ReelsA full-frame reel speaks to tradition and a design aesthetic favored by many, particularly two-handed enthusiasts. Ah, but when tradition and modern-day advantages like a large arbor and Sage's powerful, maintenance-free SCS drag are married, a new dimension of elegance and performance are attained. Introducing Sage's all-new, decidedly high-performance full-frame reel, the Domain. The Domain's line-protecting full frame removes any remote concern about running line or backing...