Products 1-48 of 73
ARX Reel ARX Reel
Price: $439.95-$499.95
Availability: In Stock
Item #: ARX -

ARX Spool ARX Reel
Price: $200.95-$225.95
Availability: In Stock
Item #: AR -

Price: $109.95
Availability: In Stock
Item #: 5-5506R -

Redington's new BEHEMOTH reel combines the most powerful drag in its class with stunning aesthetics that push the limits of fly reel design. The unique, un-machinable, die-cast construction is coupled with a durable, interlocking, large-arbor spool design that both looks and functions like a premium reel. A super-heavy duty carbon fiber drag package brings the utmost in drag strength, reliability and performance to the family. Sized for your favorite 5-weight trout rod, and all the way up to...

Bougle Reel 3-1/2" Bougle Reel 3-1/2"
Price: $595.00
Availability: In Stock
Item #: HEB040 -

Bougle Reel 4" Bougle Reel 4"
Price: $595.00
Availability: In Stock
Item #: HEB050 -

Bougle Spool 3" Bougle Spool 3"
Price: $99.00
Availability: In Stock
Item #: HSB020 -

Bougle Spool 3-1/2" Bougle Spool 3-1/2"
Price: $99.00
Availability: In Stock
Item #: HSB040 -

Bougle Spool 3-1/4" Bougle Spool 3-1/4"
Price: $99.00
Availability: In Stock
Item #: HSB030 -

Bougle Spool 4" Bougle Spool 4"
Price: $119.00
Availability: In Stock
Item #: HSB050 -

BVK Super Large Arbor Reel BVK Super Large Arbor Reel
Price: $159.95
Availability: In Stock
Item #: TFR BVK -

The story is that Lefty Kreh grew up poor, and while on the way to becoming the world's most recognized and most beloved fly angler, he also learned the art of being thrifty. Lefty is an incredible athlete in his own right. In his youth, Lefty was so uncanny in the shooting sports that Remington Firearms Company hired him to demonstrate their rifles and shot guns in front of huge crowds. During mid-life Lefty wowed thousand of anglers at sport shows my demonstrating fly casting. In his heyday...

BVK Super Large Arbor Spool BVK Super Large Arbor Spool
Price: $84.95
Availability: In Stock
Item #: TFRBVK -

Duchess Reel, 4" Duchess Reel size 9/10/11
Price: $549.00
Availability: In Stock
Item #: HREDUCG040 -

Duchess Spool, 4" Duchess Spool size 9/10/11
Price: $189.00
Availability: In Stock
Item #: HSPDUCG040 -

Echo Ion Reel Echo Ion Reel
Price: $99.99
Availability: In Stock
Item #: ION- -

The Echo Ion Reels are the best fly fishing reels we have seen in the less than $100 category. They are a hybrid design, in that they are injection molded cast aluminum, then they are machined to very exacting tolerances. This operation gives many of the benefits associated with reels that are machined from bar-stock, but with a huge reduction in manufacturing costs. This results in massive savings to the consumer (you). These reels contain ball bearings and a cork disc drag system, all of...

Echo Ion Spool Echo Ion Spool
Price: $44.95
Availability: In Stock
Item #: ION -

Finatic  1 Plus Reel Finatic  1 Plus Reel
Price: $350.00
Availability: In Stock
Item #: H1P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  1 Plus Spool Finatic  1 Plus Spool
Price: $158.00
Availability: In Stock
Item #: H1PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  3 Plus Reel Finatic  3 Plus Reel
Price: $400.00
Availability: In Stock
Item #: H3P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  3 Plus Spool Finatic  3 Plus Spool
Price: $175.00
Availability: In Stock
Item #: H3PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  4 Plus Reel Finatic  4 Plus Reel
Price: $450.00
Availability: In Stock
Item #: H4P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  4 Plus Spool Finatic  4 Plus Spool
Price: $190.00
Availability: In Stock
Item #: H4PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  5 Plus Reel Finatic  5 Plus Reel
Price: $500.00
Availability: In Stock
Item #: H5P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  5 Plus Spool Finatic  5 Plus Spool
Price: $205.00
Availability: In Stock
Item #: H5PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  7 Plus Reel Finatic  7 Plus Reel
Price: $600.00
Availability: In Stock
Item #: H7P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  7 Plus Spool Finatic  7 Plus Spool
Price: $225.00
Availability: In Stock
Item #: H7PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  9 Plus Reel Finatic  9 Plus Reel
Price: $750.00
Availability: In Stock
Item #: H9P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic  9 Plus Spool Finatic  9 Plus Spool
Price: $350.00
Availability: In Stock
Item #: H9PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic 11 Plus Reel Finatic 11 Plus Reel
Price: $825.00
Availability: In Stock
Item #: H11P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic 11 Plus Spool Finatic 11 Plus Spool
Price: $375.00
Availability: In Stock
Item #: H11PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic 12 Plus Reel Finatic 12 Plus Reel
Price: $900.00
Availability: In Stock
Item #: H12P -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Finatic 12 Plus Spool Finatic 12 Plus Spool
Price: $400.00
Availability: In Stock
Item #: H12PEXS -

Hatch Rep, Bruce Berry spent some time at our Deschutes River Steelhead camp last year, and left one of his pet Spey setups for me to evaluate for a week. The core of this outfit was a Beulah Platinum SP1266-4 rod, and a Hatch Finatic 7 Plus reel. We had already been a Beulah Rod dealer for a couple of years. Beulah has a solid fan club, and has always shown steady predictable sales growth with a minimum of hassles. Hatch is a comparatively new company, and I had been keeping my eye on it for...

Guru Series II Reel Lamson Guru Series II Reel
Price: $199.95-$269.95
Availability: In Stock
Item #: G -

Steadfast and stylish, Guru has long set a standard as a rugged, fully USA-machined ultra-reliable reel at a great price. This season they've updated Guru's spool geometry for enhanced retrieve rates, opened the porting to reduce weight and improve line drying, integrated the counterbalance and introduced a curved cross section arbor for structural stability. Guru continues to prove that the quest for enlightenment can be anything but boring. MODEL DIA WIDTH WEIGHT ROD WT LINE CAPACITY Guru 1...

Guru Series II Spool Guru Series II
Price: $99.95-$129.95
Availability: In Stock

Steadfast and stylish, Guru has long set a standard as a rugged, fully USA-machined ultra-reliable reel at a great price. This season we've updated Guru's spool geometry for enhanced retrieve rates, opened the porting to reduce weight and improve line drying, integrated the counterbalance and introduced a curved cross section arbor for structural stability. Guru continues to prove that the quest for enlightenment can be anything but boring. MODEL DIA WIDTH WEIGHT ROD WT LINE CAPACITY Guru 1...

Liquid Liquid
Price: $99.95
Availability: In Stock
Item #: LQ -

Loon Reel Lube Loon Reel Lube
Price: $5.50
Availability: In Stock
Item #: 401 -

A combination of lubricants and water repellent, Reel Lube gives reels extended protection from rust and friction. It will increase the performance and lifetime of a reel.

Loop Classic Reel Loop Classic Reel
Retail: $679.00
Price: $569.00
Availability: In Stock
Item #: CR -

There are very few classic American type fly reels available on the market today. Those that have survived are mostly built by small shops at huge prices. The Loop Classic is both more affordable and more reliable than any of the competitors. The Loop Classic is equipped with ventilated or solid side-plates. I have owned a Loop Classic 811 since first production in the early 1990's. It is my favorite reel for hunting very large anadromous fish in large rivers, because the drag system can get...

Marquis LWT Reel Marquis Reel No. 3
Price: $329.00-$449.00
Availability: In Stock
Item #: HREMARGO -

The Marquis has been a mainstay of the Hardy line since the early 1970's when it was introduced to the US market as the Scientific Anglers System Reel. Thousands of Americans bought this English-made reel and most of them are still in use. The LTW is actually the third generation of the Marquis. Each generation has shown subtle improvements in performance without sacrificing the simplicity and rugged performance of the original Marquises. All the spools are interchangeable with all other...

Marquis Reel Marquis Reel
Price: $325.00
Availability: In Stock
Item #: HREM0 -

Marquis Spool Marquis Spool
Price: $89.00-$109.00
Availability: In Stock
Item #: HSPM0 -

Prism Cast Large Arbor Reel Prism Cast Large Arbor Reel
Price: $99.95
Availability: In Stock
Item #: 8332S -

Prism Cast Large Arbor Spool Prism Cast Large Arbor Spool
Price: $44.95
Availability: In Stock
Item #: TFR P CLA -

Consistent with TFO's tradition of offering high performance gear at an affordable price, the new Prism Cast Large Arbor Reels are made from cast aluminum with a cork disc drag and a one way clutch bearing for instant drag engagement. They feature quick change spools and easy LH/RH conversion.The Prism Series are very good reels at affordable prices.MODELDESCRIPTIONDIAMETERWIDTHWEIGHTCAPACITYPRICETFR P CLA 3/4TFO Prism Cast Large Arbor Reel 3/42.75"1"4.9 oz.80 yards/20lb./WF3F$89.95TFR P CLA...

Sage 2200 Series Reels Sage 2200 Series Reels
Price: $129.00-$159.00
Availability: In Stock
Item #: 330-22 -

Own "wow" for less. Sage is further expanding the popularity of their hard-fighting 4200 series with the all-new, value conscious 2200 series. A large arbor with rugged machined die-cast frame, generous concave spool surface, whisper-smooth carbon drag and unexpected finishing touches like its fully machined drag knob and handle, the 2200 gives you more than the fish bargained for.

Sage 3200 Series Reels Sage 3200 Series Reels
Price: $199.00-$259.00
Availability: In Stock
Item #: 324-32 -

Excellence runs in the family. Introducing the first of two all-new and price-savvy relatives to the 4200, the fully machined 3200. A bit smaller in diameter than the 4200 but still a true large arbor, it has the same concave spool surface as the 4200 for optimal line capacity and drag-assisting smoothness. Lightweight, extremely durable and packed with features you'd expect on higher priced reels, this one just goes out and quietly performs day after day.

Sage 4200 Series Reels Sage 4200 Series Reels, fly fishing reels, machined from bar stock, waterproof drag system, fresh water reel, saltwater reel
Price: $289.00-$319.00
Availability: In Stock
Item #: 322-42 -

Sage 4200 Series Reels Mark landed this native Deschutes redband trout with a Sage 3110-4 ONE Trout Spey rod, equipped with a Sage 4250 reel and 275-grain RIO Skagit Max Short line. The drag systems in 4200 series reels are waterproof, and impressively smooth. Featuring state of the art lightweight construction with a fully sealed drag, at an exceptional value. Sage's 4200 series reel offering brings a sophisticated, high-performance drag system. The one-revolution drag knob offers quick and...

Sage 4600 Series Reels Sage 4600 Series Reels
Price: $375.00-$450.00
Availability: In Stock
Item #: 320-46 -

True large arbor performance with new features.This all-new large arbor reel features a notably larger-diameter spool and arbor for faster line retrieval and consistently smooth drag during battle. Its larger size contributes to added rigidity and strength for overall performance. The inner arbor is concave for greater line and backing capacity. Lightweight and streamlined, the 4600 series has a powerful 3:1 drag ratio that gives it the same performance as a traditional centered disc drag...

Sage 6200 Series Reels Sage 6200 Series Reels
Price: $439.00-$499.00
Availability: In Stock
Item #: 32-62 -

NEW for 2017! Sage 6200 Series Reels with SERIOUS STOPPING POWER The new 6200 Series is fully machined with cold forged, tempered 6061-T6 aluminum, housing Sage's proven Sealed Carbon System (SCS) Drag. The 6200 features a super rigid frame-to-spool connection, a widened palming rim, a large/vented arbor for high retrieve rate, and Sage's One Revolution Drag Knob with 40 detented drag settings for adjustable and repeatable drag resolution. Finished with their Essential Collection's unique...

Sage Click Reels Sage Click Reels
Price: $259.00-$299.00
Availability: In Stock
Item #: 323-C -

Sage's new CLICK Series reels are a performance and cosmetic upgrade from the original CLICK series. The enhanced CLICK features larger arbor diameters creating a larger palming area for fighting fish and quicker line retrieval while maintaining backing capacities. The CLICK aesthetic has been elevated through new hole patterns and a refreshed, modern design that speaks to its lightweight and minimalist yet functional characteristics. The proven performance of the adjustable click and pawl...

Sage Domain Reels Sage Domain Reels
Price: $345.00-$385.00
Availability: In Stock
Item #: 321-DMN -

Sage Domain ReelsA full-frame reel speaks to tradition and a design aesthetic favored by many, particularly two-handed enthusiasts. Ah, but when tradition and modern-day advantages like a large arbor and Sage's powerful, maintenance-free SCS drag are married, a new dimension of elegance and performance are attained. Introducing Sage's all-new, decidedly high-performance full-frame reel, the Domain. The Domain's line-protecting full frame removes any remote concern about running line or backing...